PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI05G17830.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LBD
Protein Properties Length: 280aa    MW: 28087.4 Da    PI: 8.1341
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI05G17830.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601407.8e-4440138199
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrrkC++dCv+apyfp ++p+kf  vh++FGasnv+kll++l++ +reda++sl+yeA++r+rdPvyG+vgvi+ lq+ql+ql+++l
  ORUFI05G17830.1  40 PCAACKFLRRKCQPDCVFAPYFPPDNPQKFVHVHRVFGASNVTKLLNELHPYQREDAVNSLAYEADMRLRDPVYGCVGVISVLQHQLRQLQQDL 133
                      7********************************************************************************************* PP

           DUF260  95 allke 99 
                      ++++ 
  ORUFI05G17830.1 134 SRARF 138
                      99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.86139140IPR004883Lateral organ boundaries, LOB
PfamPF031957.7E-4440136IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MAASSSASSL PLSSGSVITV SSSPAVGASS GGGGGGTGSP CAACKFLRRK CQPDCVFAPY  60
FPPDNPQKFV HVHRVFGASN VTKLLNELHP YQREDAVNSL AYEADMRLRD PVYGCVGVIS  120
VLQHQLRQLQ QDLSRARFEL SKYQAAVAVS SSNGQAAAAA AMVDHFIGSA VQPNCTQNFI  180
SGGGVAAAAI GVGGGAGGGF VNDHHQFSAV QMLARSYDGE SAVARLGGAV NVSGGGGYEF  240
GYSSAMGGAG GPMSGLGPLG GGTFLKPGTA GGGDRPTAAQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126130.0CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015640071.11e-149PREDICTED: LOB domain-containing protein 6
RefseqXP_015640070.11e-149PREDICTED: LOB domain-containing protein 6
SwissprotQ32SG31e-109LBD6_MAIZE; LOB domain-containing protein 6
TrEMBLA0A0E0PMJ90.0A0A0E0PMJ9_ORYRU; Uncharacterized protein
STRINGBGIOSGA018046-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22673895
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.46e-54LBD family protein